PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013697.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 572aa    MW: 61230.5 Da    PI: 8.5927
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013697.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.43.3e-103433801954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  Do013697.1 343 FEHflHPYPTDSDKQLLAKQTGLTRNQVSNWFINARVR 380
                 554458******************************98 PP

2BELL98.17.4e-32210279372
        BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +e q +k++L+sl+e V++rYkqy++qlq vissFe vagl +a+p++s+Al+++S+hF+cLk +i +q+
  Do013697.1 210 AEQQWRKTRLISLMEDVCRRYKQYYQQLQSVISSFESVAGLSNAAPFASMALRTMSKHFKCLKGMILNQL 279
                 58899*************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.5E-39138277IPR006563POX domain
PfamPF075261.1E-37143275IPR006563POX domain
PROSITE profilePS5007112.374321384IPR001356Homeobox domain
SMARTSM003899.4E-11324388IPR001356Homeobox domain
CDDcd000864.28E-14324385No hitNo description
SuperFamilySSF466898.55E-17326391IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-28327388IPR009057Homeodomain-like
PfamPF059203.0E-18341380IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MSSAAGGGYG GGGAEHHQQH LLLGQAAGQL YHVPQHSRRE KLRFPHDPAD SSPPPAAWPA  60
AAPPFYSYAS SSTSSYSPHS PTLAHAQLVA HALPAGAGAQ IPSQNFALSL SSASSNPPPA  120
PRRHLAAGVA TGPYGPFTGY AAVLGRSRFL GPAQKLLEEI CDVGGRAVQV DRRSDDGLLD  180
MDAMDAPGDV DHDMDGGDRA AAEAVAVSGA EQQWRKTRLI SLMEDVCRRY KQYYQQLQSV  240
ISSFESVAGL SNAAPFASMA LRTMSKHFKC LKGMILNQLR NTSKVAANDG MGKEDMANFA  300
LMGGGSGLLR GNSVNAFSQP HNIWRPQRGL PERAVSVLRS WLFEHFLHPY PTDSDKQLLA  360
KQTGLTRNQV SNWFINARVR LWKPMVEEIH NLEMRQQHKN PSLNKNQLGM QQSQHSSDSS  420
GKPSDPSSSR RGQSSGMTTR NLSSPASRNI QDELCHMAHD MPGQVSFAYN GLAAHHGLAL  480
SHPQQAEGVS AGGVGVGGGA AANGGVSLTL GLHQNNRTYI AEPLPAALPL NLAHRFGLED  540
VSDAYVMGSF GGQDRHFTKE IGGHHLVHDF VG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A7e-17330388563Homeobox protein Meis2
4xrm_B7e-17330388563Homeobox protein Meis2
4xrs_A5e-17330387158Homeobox protein Meis1
4xrs_B5e-17330387158Homeobox protein Meis1
5bng_A6e-17330388159Homeobox protein Meis2
5bng_B6e-17330388159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961888.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLK3Z5080.0K3Z508_SETIT; Uncharacterized protein
STRINGSi021626m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.15e-76TALE family protein